missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ErbB4 (aa 995-1097) Control Fragment Recombinant Protein

Product Code. 30209996
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209996 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209996 Supplier Invitrogen™ Supplier No. RP88798

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82452 (PA5-82452. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Oncogene ERBB4 (HER4) is a member of the type I receptor protein tyrosine subfamily that includes EGFR, ERBB2, and ERBB3. ERBB4 binds and is activated by neuregulins and other factors and induces a variety of cellular responses including mitogenesis and differentiation. ErbB 4 is activated by neuregulins and NTAK (neural and thymus derived activator for ErbB kinases). ErbB 4 is a receptor for heregulin and is capable of mediating HGL-stimulated tyrosine phosphorylation of itself. Like other protein kinases, ErbB 4 mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism, transcription, cell cycle progression, cytoskeletal rearrangement and cell movement, apoptosis, and differentiation. ErbB 4 is most predominantly expressed in several breast carcinoma cell lines, and in normal skeletal muscle, heart, pituitary, brain, and cerebellum. Breast tumor cell lines T47-D, MDA-MB-453, BT-474 and H3396 are found to have the highest levels of mRNA, and intermediate levels are seen in MCF-7, MDAMB-330 and MDA-MB-361. Expression of ErbB 4 is low or absent in some breast tumor cell lines such as MDA-MB-231, MDA-MB-157, MDA-MB-468, and SKBR-3. ErbB 4 levels have been found to be elevated in certain human tumor cell lines suggesting that it may play a role in some malignancies.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15303
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2066
Name Human ErbB4 (aa 995-1097) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4 ICD; ALS19; avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4; avian erythroblastosis oncogene B 4; c-erbB-4; erb-b2 receptor tyrosine kinase 4; Erbb4; ERBB4 intracellular domain; ERBB4 transcript variant I12DEL; ERBB4 transcript variant I20DEL; Her4; human epidermal growth factor receptor 4; Mer4; OTTHUMP00000209432; p180erbB4; proto-oncogene-like protein c-ErbB-4; receptor tyrosine kinase; receptor tyrosine-protein kinase erbB-4; s80HER4; Tyro-2; Tyrosine kinase-type cell surface receptor HER4; v-erb-a erythroblastic leukemia viral oncogene homolog 4; v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian); v-erb-b2 avian erythroblastic leukemia viral oncogene 4; v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4
Common Name ErbB4
Gene Symbol ERBB4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.