missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human ERI1 (aa 267-333) Control Fragment Recombinant Protein

Product Code. 30210145
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210145

Brand: Invitrogen™ RP103218

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63143 (PA5-63143. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA exonuclease that binds to the 3'-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2' and 3'-hydroxyl groups at the last nucleotide of the histone 3'-end is required for efficient degradation of RNA substrates. Also able to degrade the 3'-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Requires for binding the 5'-ACCCA-3' sequence present in stem-loop structure. Able to bind other mRNAs. Required for 5.8S rRNA 3'-end processing. Also binds to 5.8s ribosomal RNA. Binds with high affinity to the stem-loop structure of replication-dependent histone pre-mRNAs.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IV48
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 90459
Name Human ERI1 (aa 267-333) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3' exoribonuclease; 3' exoribonuclease; 3110010F15Rik; 3'-5' exonuclease ERI1; 3'-5' exoribonuclease 1; 3'EXO; 3'HEXO; enhanced RNAi protein 1; enhanced RNAi three prime mRNA exonuclease homolog 1; ERI1; eri-1; Eri-1 homolog; exoribonuclease 1; HEXO; histone mRNA 3' end-specific exonuclease; histone mRNA 3'-end-specific exoribonuclease; Histone mRNA 3'-exonuclease 1; protei; protein 3'hExo; RGD1308378; The x 1; three prime histone mRNA exonuclease 1; three prime mRNA exonuclease 1
Common Name ERI1
Gene Symbol ERI1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.