missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FAK (aa 276-420) Control Fragment Recombinant Protein

Product Code. 30198383
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198383

Brand: Invitrogen™ RP95931

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Focal Adhesion Kinase (FAK) is a 125 kDa non-receptor protein tyrosine kinase that acts as a substrate for Src and is a key element of integrin signaling. FAK plays an important role in cell spreading, differentiation, migration, cell death, and acceleration of the G1 to S phase transition of the cell cycle. FAK has a central catalytic domain and a C-terminal tail that localizes it to focal adhesions, which are sites where cells attach to the extracellular matrix via surface integrin receptors. Increased FAK tyrosine phosphorylation occurs upon integrin engagement with fibronectin. Adhesion of murine NIH3T3 fibroblasts to fibronectin promotes association of the Grb2 adapter protein and c-Src PTK with FAK in vivo, and also results in activation of the ERK2 MAP kinase. In v-Src-transformed NIH3T3, the association of v-Src, Grb2, and Sos with FAK is independent of cell adhesion to fibronectin. In vitro the Grb2 SH2 domain binds directly to tyrosine-phosphorylated FAK, and the binding site has been identified as Tyr925 by site directed mutagenesis. Several transcript variants encoding different isoforms have been found for the FAK gene, but the full-length natures of only three of them have been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q05397
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5747
Name Human FAK (aa 276-420) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CG10023; CG10023-PA; CG10023-PB; CG10023-PC; CG10023-PD; CG10023-PF; CG10023-PG; CT28129; DFAK; DFak56; Dmel\CG10023; Dmel_CG10023; DmFAK; EC 2.7.10.2; Fadk; FADK 1; Fak; Fak1; Fak56; fak56D; FAK65D; Fak-PA; Fak-PB; Fak-PC; Fak-PD; Fak-PF; Fak-PG; FAK-related non-kinase polypeptide; focal adhesion kinase; Focal adhesion kinase 1; focal adhesion kinase homolog; focal adhesion kinase isoform FAK-Del33; focal adhesion kinase pp125FAK; focal adhesion kinase-related nonkinase; focal ashension kinase 1; FRNK; I79_019430; Kiaa4203; mKIAA4203; p125FAK; p41/p43FRNK; pFAK; pp125 PTK2; pp125FAK; PPP1R71; Protein phosphatase 1 regulatory subunit 71; protein phosphatase 1, regulatory subunit 71; protein tyrosine kinase 2; protein tyrosine kinase 2 L homeolog; protein-tyrosine kinase; protein-tyrosine kinase 2; PTK2; PTK2 protein tyrosine kinase 2; ptk2.L; tyrosine kinase; XELAEV_18032408mg; XPFAK
Common Name FAK
Gene Symbol PTK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFIIRPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.