missing translation for 'onlineSavingsMsg'
Läs mer

Invitrogen™ Human FAM13B (aa 6-95) Control Fragment Recombinant Protein

Produktkod. 30197689
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
Förpackningsstorlek
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30197689

missing translation for 'mfr': Invitrogen™ RP106016

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65314 (PA5-65314. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM13B is a 915 amino acid protein that is encoded by a gene that maps to human chromosome 5. With 181 million base pairs encoding around 1,000 genes, chromosome 5 is about 6% of human genomic DNA. It is associated with Cockayne syndrome through the ERCC8 gene and familial adenomatous polyposis through the adenomatous polyposis coli (APC) tumor suppressor gene. Treacher Collins syndrome is also chromosome 5 associated and is caused by insertions or deletions within the TCOF1 gene. Deletion of the p arm of chromosome 5 leads to Cri du chat syndrome. Deletion of 5q or chromosome 5 altogether is common in therapy-related acute myelogenous leukemias and myelodysplastic syndrome.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q9NYF5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51306
Name Human FAM13B (aa 6-95) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610024E20Rik; ARHGAP49; AW060714; AW546153; C5orf5; Fam13b; FAM13B1; family with sequence similarity 13 member B; family with sequence similarity 13, member B; family with sequence similarity 13, member B1; GAP-like protein N61; KHCHP; N61; protein FAM13B; RGD1310484
Common Name FAM13B
Gene Symbol FAM13B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SPSLSNCNSVLANKIFGIPLDELQQGGHPDNEVPFIVRHVVDYIEEHGGLEQQGLFQVNGNAETVEWLRQRYDSGEEVDLVKEADVPSAI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.