missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196001

Invitrogen™ Human FOXJ1 (aa 183-307) Control Fragment Recombinant Protein

Codice prodotto. 30196001
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Questo articolo non è restituibile. Consulta la politica di reso

Codice prodotto. 30196001

missing translation for 'mfr': Invitrogen™ RP102512

Please to purchase this item. Need a web account? Register with us today!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52189 (PA5-52189. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Forkhead-box J1 (FOXJ1) is a 421-amino acid transcription factor that suppresses T cell activity and spontaneous autoimmunity, through the repression of NF B activity. FOXJ1 also inhibits the humoral immune response in B cells. FOXJ1 deficiency in B cells results in spontaneous and accentuated germinal center formation and is implicated in the development of pathogenic autoantibodies and accentuated responses to immunizations. Abnormal expression of FOXJ1 may be associated with autoimmune diseases and/or other inflammatory diseases. FOXJ1 is also required for cilia formation and left-right axis determination because it increases calpastatin expression, a protein necessary for the ability of basal bodies to anchor to the apical cytoskeleton. FOXJ1 expression may function as an early marker of epithelial cell differentiation, recovery, and function.
TRUSTED_SUSTAINABILITY

Specifica

Accession Number Q92949
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2302
Name Human FOXJ1 (aa 183-307) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias FKHL13; FKHL-13; fork head homologue 4; forkhead box J1; forkhead box protein J1; forkhead transcription factor HFH-4; forkhead-like 13; forkhead-related protein FKHL13; Foxj1; Hepatocyte nuclear factor 3 forkhead homolog 4; Hfh4; HFH-4; HNF-3/forkhead homolog 4; MGC35202
Common Name FOXJ1
Gene Symbol FOXJ1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PREKDEPGKGGFWRIDPQYAERLLSGAFKKRRLPPVHIHPAFARQAAQEPSAVPRAGPLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRVAKVPRPPSTLLPTPEEQGELEPLKG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato