missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GFAP (aa 94-142) Control Fragment Recombinant Protein

Product Code. 30206048
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206048

Brand: Invitrogen™ RP103980

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GFAP (Glial fibrillary acidic protein) is a member of the class III intermediate filament protein family. GFAP is heavily and specifically expressed in astrocytes and certain astroglia of the central nervous system, in satellite cells of peripheral ganglia, and in non-myelinating Schwann cells of peripheral nerves. In addition, neural stem cells strongly express GFAP. Antibodies to GFAP are very useful as markers of astrocytic cells. In addition, many types of brain tumor, presumably derived from astrocytic cells, heavily express GFAP. GFAP is also found in the lens epithelium, Kupffer cells of the liver, in some cells in salivary tumors and has been reported in erythrocytes. GFAP is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing of the GFAP gene results in multiple transcript variants encoding distinct isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P14136
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2670
Name Human GFAP (aa 94-142) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330404F12Rik; 65 kDa glutamic acid decarboxylase; AI836096; ALXDRD; Astrocyte or Intermediate Filament Protein; cb345; class III intermediate filament protein; etID36982.3; FLJ45472; GAD(65); Gad2; Gad-2; GAD65; GAD-65; GFAP; GFAP epsilon; gfap protein; gfapl; glial fibrillary acidic protein; Glial Fibrillary Acidic Protein (GFAP); glial fibrillary acidic protein alpha; glutamate decarboxylase 2; Glutamate decarboxylase 65 kDa isoform; glutamic acid decarboxylase 2; I79_011607; intermediate filament; intermediate filament protein; intermediate filament protein; GFAP; Unknown (protein for MGC:139638); wu:fb34h11; wu:fk42c12; xx:af506734; zgc:110485; zGFAP; intermediate filament protein; zrf-1 antigen
Common Name GFAP
Gene Symbol GFAP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.