missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GLI3 (aa 1341-1484) Control Fragment Recombinant Protein

Product Code. 30204326
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204326

Brand: Invitrogen™ RP94756

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P10071
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2737
Name Human GLI3 (aa 1341-1484) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACLS; add; AI854843; anterior digit pattern deformity; AU023367; Bph; brachyphalangy; extra toes; GCPS; GLI family zinc finger 3; GLI family zinc finger 3 L homeolog; gli3; GLI3 C-terminally truncated form; GLI3 form of 190 kDa; GLI3 form of 83 kDa; GLI3 full length protein; GLI3 full-length protein; gli3.L; GLI3-190; GLI3-83; GLI3FL; GLI-Kruppel family member 3; GLI-Kruppel family member GLI3; GLI-Kruppel family member GLI3 (Greig cephalopolysyndactyly syndrome); glioma-associated oncogene family zinc finger 3; im:7142603; neural specific DNA binding protein; neural-specific DNA-binding protein xGLI3; oncogene GLI3; PAPA; PAP-A; PAPA1; PAPB; Pdn; PHS; polydactyly Nagoya; PPDIV; Transcriptional activator GLI3; Transcriptional repressor GLI3R; XELAEV_18031191mg; xgli3; xGLI-3; Xt; Zinc finger protein GLI3; zinc finger protein GLI3; transcriptional activator GLI3; zinc finger transcription factor Gli3
Common Name GLI3
Gene Symbol GLI3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVVRGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYSGQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.