missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202397

Invitrogen™ Human GLUT3 (aa 449-494) Control Fragment Recombinant Protein

Product Code. 30202397
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30202397 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30202397 Supplier Invitrogen™ Supplier No. RP88585

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glucose is fundamental to the metabolism of mammalian cells. Several glucose transporter protein (Glut) isoforms have been identified and shown to function in response to insulin and IGF1 induced signaling. GLUT3 is detectable in a few normal cell type spermatids in testis with active spermatogenesis, placental trophoblast membranes, and neurons in brain. GLUT3 staining is also detectable in human cancers including those of the ovary, lung, and testis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P11169
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6515
Name Human GLUT3 (aa 449-494) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA408729; AL023014; AL024341; AU040424; C78366; FLJ90380; glucose transporter 3; glucose transporter type 3, brain; Glut3; Glut-3; Slc2a3; solute carrier family 2 (facilitated glucose transporter), member 3; Solute carrier family 2 A3 (neuron glucose transporter); solute carrier family 2 member 3; solute carrier family 2, facilitated glucose transporter member 3; solute carrier family 2, member 2; solute carrier family 2, member 3
Common Name GLUT3
Gene Symbol SLC2A3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.