missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30205195

Invitrogen™ Human GOT1 (aa 114-190) Control Fragment Recombinant Protein

Product Code. 30205195
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205195

Brand: Invitrogen™ RP105317

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66689 (PA5-66689. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GOT1 is a glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P17174
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2805
Name Human GOT1 (aa 114-190) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI789014; aspartate aminotransferase 1; aspartate aminotransferase, cytoplasmic; aspartate transaminase 1; Aspat; AST1; ASTQTL1; cAspAT; cCAT; Cysteine aminotransferase, cytoplasmic; cysteine transaminase, cytoplasmic; cytosolic aspartate aminotransferase; Gaspat; GIG18; Glutamate oxaloacetate transaminase 1; glutamate oxaloacetate transaminase 1, soluble; glutamic-oxaloacetic transaminase 1; glutamic-oxaloacetic transaminase 1, soluble; glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1); GOT1; Got-1; growth-inhibiting protein 18; testis secretory sperm-binding protein Li 196 A; transaminase A
Common Name GOT1
Gene Symbol GOT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.