missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16161490

Abnova™ Human GPX1 (NP_000572, 1 a.a. - 203 a.a., U49C) Full-length Recombinant Protein with His tag

Product Code. 16161490
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16161490 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16161490 Supplier Abnova™ Supplier No. P4322.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for SDS-PAGE

This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA

Specifications

Accession Number NP_000572
Concentration 0.5 mg/mL
For Use With (Application) SDS-PAGE
Formulation Liquid
Gene ID (Entrez) 2876
Molecular Weight (g/mol) 24.2kDa
Name GPX1 (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Quality Control Testing 15% SDS-PAGE Stained with Coomassie Blue
Quantity 100 μg
Immunogen MGSSHHHHHHSSGLVPRGSHMCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLCGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA
Storage Requirements Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias GSHPX1/MGC14399/MGC88245
Common Name GPX1
Gene Symbol GPX1
Species E. coli
Recombinant Recombinant
Protein Tag His
Expression System Escherichia coli expression system
Form Liquid
Purity or Quality Grade >90% by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.