missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181609

Invitrogen™ Human GRTP1 (aa 265-329) Control Fragment Recombinant Protein

Product Code. 30181609
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181609

Brand: Invitrogen™ RP97976

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61182 (PA5-61182. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRTP1, also known as germ cell-specific gene 1-related protein, is a protein that is expressed in the testis and is involved in the regulation of spermatogenesis, the process of sperm cell development. It is a member of the GRP family of proteins, which are characterized by a conserved motif called the GRP domain. GRTP1 is thought to play a role in the differentiation of spermatogonia into spermatocytes and in the regulation of meiosis, the process of cell division that produces haploid cells. Mutations in the GRTP1 gene have been associated with male infertility. GRTP1 was identified as an HIV dependency factor (HDF), suggesting that GRTP1 may be an important drug target in HIV treatment.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5TC63
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79774
Name Human GRTP1 (aa 265-329) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5430401C05Rik; C81211; GH regulated TBC protein 1; growth hormone regulated TBC protein 1; growth hormone-regulated TBC protein 1; Grtp1; LRRGT00052; RP11-391H12.7; TBC1 domain family member 6; Tbc1d6
Common Name GRTP1
Gene Symbol GRTP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VALTLIKQHQELILEATSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.