missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199906

Invitrogen™ Human HIP1R (aa 332-413) Control Fragment Recombinant Protein

Product Code. 30199906
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199906

Brand: Invitrogen™ RP102810

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58260 (PA5-58260. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Huntingtin disease, a neurodegenerate disease, is caused by the expansion of a polymorphic glutamine tract in huntingtin. The Huntingtin Interacting Protein 1 (HIP-1) is a reportedly proapoptotic, cargo-specific adaptor protein that may be involved in the pathogenesis of Huntingtin disease. As well as playing a role in Huntingtin disease, it is likely to be involved in the recruitment of clathrin coats to lipid membranes and it may also factor in tumorigenesis by allowing the survival of precancerous and cancerous cells. Since HIP-1 expression is significantly associated with prostate and colon cancer metastasis, HIP-1 can serve as a putative prognostic factor for prostate and colon cancers.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75146
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9026
Name Human HIP1R (aa 332-413) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA410023; HIP12; HIP-12; Hip1r; HIP1-related protein; HIP3; huntingtin interacting protein 1 related; huntingtin interacting protein 12; Huntingtin-interacting protein 12; huntingtin-interacting protein 1-related protein; ILWEQ; KIAA0655; mKIAA0655
Common Name HIP1R
Gene Symbol HIP1R
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VVADLFDQTFGPPNGSVKDDRDLQIESLKREVEMLRSELEKIKLEAQRYIAQLKSQVNALEGELEEQRKQKQKALVDNEQLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.