missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194105

Invitrogen™ Human HK2 (aa 464-514) Control Fragment Recombinant Protein

Product Code. 30194105
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194105

Brand: Invitrogen™ RP109007

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In vertebrates there are four major glucose-phosphorylating isoenzymes, designated hexokinase I, II, III, and IV. Hexokinase activity is involved in the first step in several metabolic pathways including phosphorylation of glucose to produce glucose-6-phosphate, thus committing glucose to the glycolytic pathway. Hexokinase is an allosteric enzyme inhibited by its product GLC-6-P. Hexokinase 2 is the predominant hexokinase isozyme expressed in insulin-responsive tissues such as skeletal muscle. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P52789
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3099
Name Human HK2 (aa 464-514) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI642394; DKFZp686M1669; Hexokinase; hexokinase 2; hexokinase II; hexokinase type II; Hexokinase-2; hexokinase-2 muscle; hexokinase-2, muscle; Hexokinase-B; HK II; Hk2; HKII; HXK2; muscle form hexokinase; OTTHUMP00000202738
Common Name HK2
Gene Symbol Hk2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ADQHRARQKTLEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.