missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HM13 (aa 337-377) Control Fragment Recombinant Protein

Product Code. 30202252
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202252

Brand: Invitrogen™ RP106681

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65995 (PA5-65995. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. May play a role in graft rejection. May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein. Involved in the intramembrane cleavage of the integral membrane protein PSEN1. Cleaves the integral membrane protein XBP1 isoform 1 in a DERL1/RNF139- dependent manner.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TCT9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81502
Name Human HM13 (aa 337-377) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1200006O09Rik; 4930443L17Rik; 5031424B04Rik; AV020344; cb228; H13; H-13; hIMP1; histocompatibility (minor) 13; histocompatibility 13; histocompatibility minor 13; HM13; hm13 protein; IMP1; IMP-1; IMPAS; IMPAS-1; intramembrane aspartyl protease; intramembrane protease 1; minor histocompatibility antigen 13; minor histocompatibility antigen H13; MSTP086; presenilin-like aspartyl protease; presenilin-like protein 3; PSENL3; PSL3; Signal peptide peptidase; signal peptide peptidase beta; signal peptide peptidase like 1; SPP; SPPL1; Unknown (protein for MGC:134054); wu:fc11a06; zgc:56660; zgc:86862
Common Name HM13
Gene Symbol HM13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGEVTEMFSYEESNPKDPAAVTESKEGTEASASKGLEKKEK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.