missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HRI (aa 34-180) Control Fragment Recombinant Protein

Codice prodotto. 30212749
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Questo articolo non è restituibile. Consulta la politica di reso

Codice prodotto. 30212749

missing translation for 'mfr': Invitrogen™ RP91431

Please to purchase this item. Need a web account? Register with us today!

Questo articolo non è restituibile. Consulta la politica di reso

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82551 (PA5-82551. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EIF2AK1 (HRI) is one of 4 kinases that specifically phosphorylate Ser51 of translation initiation factor eIF2-alpha in response to various environmental stresses, leading to a decrease in protein sythesis. In the case of EIF2AK1, signaling is initiated by low levels of heme. The HRI gene is localized to 7p22 where its 3' end slightly overlaps the 3' end of the gene JTV1. The two genes are transcribed from opposite strands and kinase activity is induced by low levels of heme and inhibited by the presence of heme.
TRUSTED_SUSTAINABILITY

Specifica

Accession Number Q9BQI3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27102
Name Human HRI (aa 34-180) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EIF2AK1; eukaryotic translation initiation factor 2 alpha kinase 1; eukaryotic translation initiation factor 2-alpha kinase 1; HCR; he; heme regulated initiation factor 2 alpha kinase; heme sensitive initiation factor 2 A kinase; heme-controlled repressor; Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase; heme-regulated inhibitor; heme-regulated initiation factor 2-alpha kinase; heme-regulated repressor; hemin-sensitive initiation factor 2 A kinase; hemin-sensitive initiation factor 2-alpha kinase; Hri; KIAA1369; PRO1362
Common Name HRI
Gene Symbol EIF2AK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Vedi altri risultati Mostra meno risultati
Correzione del contenuto del prodotto

Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.

Titolo del prodotto

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.

Grazie per averci aiutato a migliorare il nostro sito web. Il vostro feedback è stato inviato