missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202629

Invitrogen™ Human HUWE1 (aa 2532-2679) Control Fragment Recombinant Protein

Product Code. 30202629
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202629

Brand: Invitrogen™ RP92119

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51719 (PA5-51719. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SUFU encodes a component of the Sonic hedgehog (SHH; MIM 600725)/Patched (PTCH; MIM 601309) signaling pathway. Mutations in genes encoding components of this pathway are deleterious for normal development and are associated with cancer-predisposing syndromes (e.g., HPE3, MIM 142945; BCNS, MIM 109400; and GCPS, MIM 175700).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z6Z7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10075
Name Human HUWE1 (aa 2532-2679) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5430439H10Rik; ARF-binding protein 1; ARF-BP1; AU041296; BJ-HCC-24 tumor antigen; C430014N20Rik; C80292; E3 ubiquitin-protein ligase HUWE1; E3Histone; Gm1718; HECT domain protein LASU1; HECT, UBA and WWE domain containing 1; HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase; HECT, UBA and WWE domain-containing protein 1; HectH9; HECT-type E3 ubiquitin transferase HUWE1; Homologous to E6AP carboxyl terminus homologous protein 9; HSPC272; HUWE1; Ib772; Kiaa0312; KIAA1578; Large structure of UREB1; LASU1; Mcl-1 ubiquitin ligase; Mcl-1 ubiquitin ligase E3; Mule; RP3-339A18.4; upstream regulatory element binding protein 1; upstream regulatory element-binding protein 1; Ureb1; URE-B1; URE-binding protein 1
Common Name HUWE1
Gene Symbol HUWE1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGSSTTRLTQGIGRSQRTLRQLTANTGHTIHVHYPGNRQPNPPLILQRLLGPSAAADILQLSSSLPLQSRGRARLLVGNDDVHIIARSDDELLDDFFHDQSTATSQAGTLSSIPTALTRWTEECKVLDAESMHDCVSVVKVSIVNHLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.