missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IFNLR1 (aa 121-226) Control Fragment Recombinant Protein

Product Code. 30203941
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30203941 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30203941 Supplier Invitrogen™ Supplier No. RP90552

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53583 (PA5-53583. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IU57
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 163702
Name Human IFNLR1 (aa 121-226) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias class II cytokine receptor 12; class II cytokine receptor CRF2/12; CRF2/12; CRF2-12; Cytokine receptor class-II member 12; cytokine receptor family 2 member 12; IFN-lambda R1; IFN-lambda receptor 1; IFN-lambda-R1; IFNLR; IFNLR1; IL-28 receptor subunit alpha; IL-28R1; Il28ra; IL-28 RA; IL-28 R-alpha; Interferon lambda receptor 1; interferon lambda, receptor 1; interferon, lambda receptor 1; interferon-lambda receptor 1; interleukin 28 alpha receptor; interleukin 28 receptor A; interleukin 28 receptor alpha; interleukin 28 receptor, alpha (interferon, lambda receptor); interleukin or cytokine receptor 2; Interleukin-28; interleukin-28 receptor subunit alpha; LICR2; Likely interleukin or cytokine receptor 2; RGD1562689
Common Name IFNLR1
Gene Symbol Ifnlr1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEAN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.