missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IKK alpha (aa 592-737) Control Fragment Recombinant Protein

Product Code. 30180968
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30180968 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30180968 Supplier Invitrogen™ Supplier No. RP99394

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-81940 (PA5-81940. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CHUK (IKK alpha) is a serine/threonine kinase involved in signal transduction and cellular communication. It belongs to the cytokine activated protein complex that is an inhibitor of the NF-kappa B complex. IKK alpha along with IKK beta and a regulatory protein NEMO (IKK gamma) phosphorylates IkB proteins which targets the later for ubiquitin mediated degradation. It is involved with several cellular processes with extensive studies on its role in inflammation and cell survival.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O15111
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1147
Name Human IKK alpha (aa 592-737) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI256658; CHUK; Chuk1; component of inhibitor of nuclear factor kappa B kinase complex; conserved helix-loop-helix ubiquitous kinase; EC 2.7.11.10; Fbx24; Fbxo24; FLJ40509; I kappa B kinase 1; i kappa-B kinase alpha; ikappaB kinase; I-kappa-B kinase 1; I-kappa-B kinase 2; IkappaB kinase alpha; I-kappa-B kinase alpha; I-kappa-B kinase-alpha; IkB kinase alpha subunit; IkB kinase-alpha; ikBKA; IKBKB; IKK alpha; IKK1; IKK2; Ikka; IKK-A; IKK-a kinase; IKK-alpha; IKKB; IKK-B; IKK-beta; Inhibitor of nuclear factor kappa-B kinase subunit alpha; kinase beta; MGC131801; NFKBIKA; NFKBIKB; Nuclear factor NFkappaB inhibitor kinase alpha; Nuclear factor NF-kappa-B inhibitor kinase alpha; TCF16; TCF-16; Transcription factor 16
Common Name IKK alpha
Gene Symbol CHUK
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HTVQSQDRVLKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.