missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206058

Invitrogen™ Human IL11RA (aa 143-233) Control Fragment Recombinant Protein

Product Code. 30206058
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206058

Brand: Invitrogen™ RP110226

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144769 (PA5-144769. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hematopoietic cytokine receptor family. This particular receptor is very similar to ciliary neurotrophic factor, since both contain an extracellular region with a 2-domain structure composed of an immunoglobulin-like domain and a cytokine receptor-like domain. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2012].
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14626
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3590
Name Human IL11RA (aa 143-233) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI314697; CRSDA; Enhancer trap locus homolog 2; Etl2; etl-2; GP130; IL-11 receptor subunit alpha; IL-11 receptor subunit alpha-1; IL-11 R subunit alpha; IL-11 R subunit alpha-1; Il11ra; IL-11 RA; Il11ra1; IL-11 RA1; Il11ra2; Il-11 ra-alpha; IL-11 R-alpha; IL-11 R-alpha-1; interleukin 11 receptor subunit alpha; interleukin 11 receptor, alpha; interleukin 11 receptor, alpha chain 1; interleukin 11 receptor, alpha chain 2; interleukin-11 receptor alpha chain; interleukin-11 receptor subunit alpha; Interleukin-11 receptor subunit alpha-1; locus 2; novel cytokine receptor 1; NR1; NR-1; sIL11RA
Common Name IL11RA
Gene Symbol IL11RA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.