missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 16181550

Abnova™ Human IL19 (Q9UHD0) Recombinant Protein

Product Code. 16181550
Change view
Click to view available options
Quantity:
10 μg
Unit Size:
10µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16181550 10 μg 10µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 16181550 Supplier Abnova™ Supplier No. P4410.10ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. [provided by RefSeq]

Sequence: mLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Specifications

Accession Number Q9UHD0
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 29949
Molecular Weight (g/mol) 17.9kDa
Name IL19 (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Quality Control Testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Quantity 10 μg
Immunogen MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
Storage Requirements Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Endotoxin Concentration <0.1 EU/μg
Gene Alias IL-10C/MDA1/NG.1/ZMDA1
Common Name IL19
Gene Symbol IL19
Biological Activity The activity is determined by the activation of STAT following receptor-ligand interaction.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.