Learn More
Abnova™ Human IL19 (Q9UHD0) Recombinant Protein
Description
The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). A similar cytokine in mouse is reported to up-regulate the expression of IL6 and TNF-alpha and induce apoptosis, which suggests a role of this cytokine in inflammatory responses. Alternatively spliced transcript variants encoding the distinct isoforms have been described. [provided by RefSeq]
Specifications
Specifications
| Accession Number | Q9UHD0 |
| For Use With (Application) | Functional Study, SDS-PAGE |
| Formulation | Lyophilized |
| Gene ID (Entrez) | 29949 |
| Molecular Weight (g/mol) | 17.9kDa |
| Name | IL19 (Human) Recombinant Protein |
| Preparation Method | Escherichia coli expression system |
| Quality Control Testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Quantity | 10 μg |
| Immunogen | MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.