missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206238

Invitrogen™ Human IMP3 (aa 91-183) Control Fragment Recombinant Protein

Product Code. 30206238
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206238

Brand: Invitrogen™ RP107045

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111518 (PA5-111518. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the human homolog of the yeast Imp3 protein. The protein localizes to the nucleoli and interacts with the U3 snoRNP complex. The protein contains an S4 domain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NV31
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55272
Name Human IMP3 (aa 91-183) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190002L16Rik; AI256594; BRMS2; C15orf12; cancer/testis antigen 98; CT98; DKFZp586L0118; FLJ10968; hKOC; IGF2 mRNA-binding protein 3; IGF2BP3; IGF-II mRNA-binding protein 3; IMP3; IMP-3; IMP3, U3 small nucleolar ribonucleoprotein; IMP3, U3 small nucleolar ribonucleoprotein, homolog; IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast); insulin like growth factor 2 mRNA binding protein 3; insulin-l; insulin-like growth factor 2 mRNA binding protein 3; insulin-like growth factor 2 mRNA-binding protein 3; KH domain containing protein overexpressed in cancer; KH domain-containing protein overexpressed in cancer; KOC; KOC1; MRPS4; OTTHUMP00000183524; RGD1306825; U3 small nucleolar ribonucleoprotein protein IMP3; U3 snoRNP protein 3 homolog; U3 snoRNP protein IMP3; VICKZ family member 3; VICKZ3
Common Name IMP3
Gene Symbol Imp3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TRGSLELCDFVTASSFCRRRLPTVLLKLRMAQHLQAAVAFVEQGHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.