missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IP3 Receptor 1 (aa 2472-2553) Control Fragment Recombinant Protein

Product Code. 30201680
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201680

Brand: Invitrogen™ RP91255

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5-trisphosphate. Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1. Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14643
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3708
Name Human IP3 Receptor 1 (aa 2472-2553) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ACV; CLA4; D6Pas2; ENSMUSG00000072853; Gm10429; I145TR; inositol 1,4,5-triphosphate receptor 1; inositol 1,4,5-triphosphate receptor, type 1; inositol 1,4,5-trisphosphate receptor 1; inositol 1,4,5-trisphosphate receptor type 1; inositol 1,4,5-trisphosphate receptor, type 1; inositol 1,4,5-trisphosphate-binding protein P400; Insp3r; InsP3R type I; insP3R1; IP3 receptor; IP3 receptor isoform 1; Ip3r; IP-3-R; IP3R 1; IP3R1; Itpr1; Itpr-1; opisthotonus; opt; P400; Pcd6; Pcp1; Pcp-1; PPP1R94; protein PCD-6; protein phosphatase 1, regulatory subunit 94; Purkinje cell protein 1; SCA15; SCA16; SCA29; SI-SIII-SIIA; Type 1 inositol 1,4,5-trisphosphate receptor; type 1 InsP3 receptor
Common Name IP3 Receptor 1
Gene Symbol Itpr1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.