missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202227

Invitrogen™ Human ITGB5 (aa 575-709) Control Fragment Recombinant Protein

Product Code. 30202227
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30202227 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30202227 Supplier Invitrogen™ Supplier No. RP100999

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Integrins are important extracellular matrix (ECM) receptor proteins located on cell surfaces. They are hetrodimers composed of an alpha and a beta transmembrane glycoprotein subunit. Around 22 different integrins (different alpha/ beta subunit combinations) are found in nature. Integrins are generally present in high concentrations at the cell surface, but, unlike most other cell-surface receptors, they bind ligands with very low affinity. Due to their weak individual binding, integrins need to cluster and bind in-groups in order to effectively bind the ECM. Integrins bind many different ligands including laminin. Each integrin is made up of a large N-terminal extracellular domain that binds the ECM ligand and a small C-terminal cytoplasmic domain that mediates interaction with the actin cytoskeleton and signaling function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P18084
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3693
Name Human ITGB5 (aa 575-709) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias [b]5; [b]-5; [b]5 A; [b]5 B; AA475909; AI874634; beta5; beta-5; CD61; ESTM23; FLJ26658; GP3A; GPIIIa; I79_000655; integrin beta 5; integrin beta-5; integrin subunit beta 5; integrin, beta 5; ITGB5; RGD1563276; testis secretory sperm-binding protein Li 217 p
Common Name ITGB5 (Integrin beta 5)
Gene Symbol Itgb5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.