missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204375

Invitrogen™ Human JIP3 (aa 711-800) Control Fragment Recombinant Protein

Product Code. 30204375
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204375 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204375 Supplier Invitrogen™ Supplier No. RP104067

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64408 (PA5-64408. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

c-Jun NH2-terminal kinases (JNKs) are distant members of the MAP kinase family. JNK1 is activated by dual phosphorylation at a Thr-Pro-Tyr motif in response to ultraviolet (UV) light, and it functions to phosphorylate c-Jun at amino terminal serine regulatory sites Ser 63 and Ser 73, resulting in transcriptional activation. Two additional JNK family members, JNK2 and JNK3, have been identified. JIP-1 (for JNK interacting protein-1) has been identified as a cytoplasmic inhibitor of JNK that retains JNK in the cytoplasm, thereby inhibiting JNK-regulated gene expression. Evidence suggests that JNK1 and JNK2 bind to JIP-1 with greater affinity than to ATF-2 and c-Jun, which are targets of the JNK signaling pathway. JIP-1 contains an amino terminal JNK binding domain and a carboxy terminal SH3 domain. ATF-2 and c-Jun also contain the JNK binding domain and are thought to compete with JIP-1 for JNK binding. Multiple splice variants of JIP-1, including JIP-1b, JIP-1c (also designated islet-brain 1 or IB-1), JIP-2a, JIP-2b and JIP-3, have been identified in brain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UPT6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23162
Name Human JIP3 (aa 711-800) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BB120594; c-Jun NH2-terminal kinase (JNK)/stress-activated protein kinase-associated protein 1; C-jun-amino-terminal kinase interacting protein 3; C-Jun-amino-terminal kinase-interacting protein 3; D17Wsu15e; homolog of Drosophila Sunday driver 2; JIP3; JIP-3; JNK MAP kinase scaffold protein 3; JNK/SAPK-associated protein 1; JNK/SAPK-associated protein 1 c; JNK/SAPK-associated protein-1; JNK/stress-activated protein kinase-associated protein 1; JNK-interacting protein 3; JSAP1; JSAP1a; JSAP1b; JSAP1c; JSAP1d; JUN/SAPK-associated protein 1; KIAA1066; MAPK8IP3; mitogen activated protein kinase 8 interacting protein 3; mitogen-activated protein kinase 8 interacting protein 3; mitogen-activated protein kinase 8-interacting protein 3; mKIAA1066; Sunday driver 2; syd; SYD2
Common Name JIP3
Gene Symbol MAPK8IP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AGVNLSGWRPNEDDAGNGVKPAPGRDPLTCDREGDGEPKSAHTSPEKKKAKELPEMDATSSRVWILTSTLTTSKVVIIDANQPGTVVDQF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.