missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199804

Invitrogen™ Human K-Ras (aa 76-109) Control Fragment Recombinant Protein

Product Code. 30199804
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199804

Brand: Invitrogen™ RP100544

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111300. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

K-RAS (GTPase KRas) belongs to the Ras oncogene family. Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. It plays an important role in the regulation of cell proliferation and has a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes in colorectal cancer cells in a ZNF304-dependent manner. Mutations in the gene can result in leukemia acute myelogenous, leukemia juvenile myelomonocytic, Noonan Syndrome, gastric cancer, and cardiofaciocutaneous syndrome 2.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P01116
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 3845
Name Human K-Ras (aa 76-109) Control Fragment
pH Range 7.4
Purification Method Metal-chelate chromatography
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AI929937; cellular c-Ki-ras2; cellular c-Ki-ras2 proto-oncogene; CFC2; c-Ki-ras; c-Kirsten-ras protein; c-Kirsten-ras proto-oncogene; c-K-ras; c-K-ras2 protein; fa04e08; fc14b12; fc23g10; fj89d12; GTPase KRas; GTPase KRas, N-terminally processed; hypothetical protein LOC445289; K RAS; ki-Ras; Kirsten rat sarcoma oncogene 2, expressed; Kirsten rat sarcoma viral (Kras-2) oncogene homolog; Kirsten rat sarcoma viral oncogene; Kirsten rat sarcoma viral oncogene homolog; Kirsten rat sarcoma viral oncogene homologue 2 (active); KRAS; K-ras; K-Ras 2; K-ras p21 protein; KRAS proto-oncogene, GTPase; KRAS1; Kras2; Kras-2; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; NS; NS3; oncogene KRAS2; p21; p21 protein; p21B; p21ras; PR310 c-K-ras oncogene; RALD; ras; ras p21; RASK; RASK2; ras-like protein; transforming protein p21; Unknown; v-Ki-ras2 Kirsten rat sarcoma 2 viral oncogene homolog; v-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog; wu:fa04e08; wu:fc14b12; wu:fc23g10; wu:fj89d12; xRAS2; zgc:85725
Common Name K-Ras
Gene Symbol KRAS
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.