missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30180631

Invitrogen™ Human KCTD15 (aa 1-45) Control Fragment Recombinant Protein

Product Code. 30180631
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180631

Brand: Invitrogen™ RP99118

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-144801 (PA5-144801, PA5-84032 (PA5-84032. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Childhood and adult obesity in the United States and to a lesser extent the rest of the world has increased dramatically over the past decade. Both environmental and genetic factors are involved in the onset and progression of weight gain. Recently, the potassium channel KCTD15 was identified as a genetic loci associated with higher than normal body mass index (BMI) in humans along with genes such as GNPDA2, MTCH2, FTO, and TMEM18. Further studies on single nucleotide polymorphisms (SNPs) in non-diabetic and diabetic patients showed that FTO was most strongly associated with obesity while MTCH2 and GNPDA2 were still significantly associated with higher than normal BMI levels. At least two isoforms of KCTD15 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96SI1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79047
Name Human KCTD15 (aa 1-45) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC031749; BTB/POZ domain-containing protein KCTD15; Kctd15; potassium channel tetramerisation domain containing 15; potassium channel tetramerization domain containing 15; potassium channel tetramerization domain-containing protein 15
Common Name KCTD15
Gene Symbol KCTD15
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.