missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198908

Invitrogen™ Human Kinesin 5B (aa 372-433) Control Fragment Recombinant Protein

Product Code. 30198908
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198908

Brand: Invitrogen™ RP104674

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Microtubule-dependent motor required for normal distribution of mitochondria and lysosomes. Can induce formation of neurite-like membrane protrusions in non-neuronal cells in a ZFYVE27-dependent manner. Regulates centrosome and nuclear positioning during mitotic entry. During the G2 phase of the cell cycle in a BICD2-dependent manner, antagonizes dynein function and drives the separation of nuclei and centrosomes. Required for anterograde axonal transportation of MAPK8IP3/JIP3 which is essential for MAPK8IP3/JIP3 function in axon elongation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P33176
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3799
Name Human Kinesin 5 B (aa 372-433) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AL022807; Conventional kinesin heavy chain; EMBL:ABC25059.1}; epididymis secretory protein Li 61; HEL-S-61; Khc; Khcs; KIF5A; KIF5B; kif5b {ECO:0000312; kinesin 1 (110-120 kD); kinesin family member 5 A; kinesin family member 5 B; kinesin heavy chain; kinesin heavy chain member 5 B, ubiquitous; kinesin-1 heavy chain; KINH; KNS; Kns1; ubiquitous kinesin heavy chain; UKHC; U-KHC; Unknown (protein for IMAGE:7944745)
Common Name Kinesin 5 B
Gene Symbol KIF5B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ETVPIDEQFDKEKANLEAFTVDKDITLTNDKPATAIGVIGNFTDAERRKCEEEIAKLYKQLD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.