missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Kir3.4 (KCNJ5) (aa 334-411) Control Fragment Recombinant Protein

Product Code. 30210024
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210024

Brand: Invitrogen™ RP90942

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53222 (PA5-53222. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

G protein-coupled inwardly rectifying potassium channels (Kir3.1 through Kir3.4) are coupled to numerous neurotransmitter receptors in the brain and are abundantly expressed in the olfactory bulb, hippocampus, neocortex, dentate gyrus, cerebellar cortex and thalamus regions of the brain. Also known as GIRK, Kir3 potassium channels localize to the soma and dendrites as well as axons of neurons. Liberated Gbg subunits from G protein heterotrimers bind to and regulate Kir3 channel activity. Gb3- and Gb4-containing Gbg dimers bind directly to cytoplasmic domains of Kir3 proteins and increase the K+ current while Gb5-containing Gbg dimers inhibit Kir3 K+ current. Kir3 activity is also inhibited by tyrosine phosphorylation. Brain-derived neurotrophic factor activates receptor tyrosine kinase B, which then phosphorylates Kir3 tyrosine residues, effectively inactivating the Kir3 channels.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P48544
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3762
Name Human Kir3.4 (KCNJ5) (aa 334-411) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cardiac ATP-sensitive potassium channel; cardiac inward rectifier; CIR; G protein-activated inward rectifier potassium channel 4; GIRK4; GIRK-4; Heart KATP channel; inward rectifier K(+) channel Kir3.4; inward rectifier K+ channel KIR3.4; IRK4; IRK-4; KATP1; KATP-1; KCNJ5; Kir3.4; LQT13; Potassium channel, inwardly rectifying subfamily J member 5; potassium channel, inwardly rectifying subfamily J, member 5; potassium inwardly-rectifying channel, subfamily J, member 5; potassium voltage-gated channel subfamily J member 5
Common Name Kir3.4 (KCNJ5)
Gene Symbol KCNJ5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.