missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200694

Invitrogen™ Human KLF3 (aa 187-257) Control Fragment Recombinant Protein

Product Code. 30200694
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200694

Brand: Invitrogen™ RP101191

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111293 (PA5-111293. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Krueppel-like factors (KLFs) comprise a family of evolutionarily conserved zinc finger-containing transcription factors with diverse regulatory functions in cell growth, proliferation, differentiation and embryogenesis. Individual members of the Sp1-like/KLF family can function either as activators or repressors, depending on which promoter they bind and the coregulators with which they interact. KLF6, also designated Zf9 or CPBP (core promoter-binding protein), and KLF3 are Kruppel-like zinc finger containing transcription factors. KLF6 is rapidly induced during hepatic stellate cell activation and transactivates a reporter gene driven by the collagen I promoter, suggesting KLF6 plays a role in the response to tissue injury. KLF3 may play a role in hematopoiesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P57682
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51274
Name Human KLF3 (aa 187-257) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 9930027G08Rik; AL024007; Basic krueppel-like factor; basic kruppel like factor; Basic Kruppel- like factor; basic Kruppel-like factor; BKLF; CACCC-box-binding protein BKLF; klf12; Klf3; Krueppel-like factor 3; kruppel like factor 12; Kruppel like factor 3; Kruppel-like factor 12; Kruppel-like factor 3 (basic); MGC48279; TEF-2; transcript ch138; zinc finger containing transcription factor
Common Name KLF3
Gene Symbol Klf3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQPGKRPLPVESPDTQRKR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.