missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204502

Invitrogen™ Human KLHL8 (aa 163-294) Control Fragment Recombinant Protein

Product Code. 30204502
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204502

Brand: Invitrogen™ RP90802

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53640 (PA5-53640. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kelch-like protein 8 is a protein that in humans is encoded by the KLHL8 gene. The mRNA contains a repetitive element in its 3-prime UTR, and the deduced 451-amino acid protein shares 36% identity with the actin-binding protein MAYVEN. RT-PCR ELISA detected highest expression in adult brain, liver, skeletal muscle, kidney, and ovary, and in several specific brain regions, predominantly amygdala and thalamus. Moderate expression was detected in all other adult and fetal tissues examined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P2G9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57563
Name Human KLHL8 (aa 163-294) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310001P09Rik; D5Ertd431e; kelch like family member 8; kelch-like 8; kelch-like family member 8; kelch-like protein 8; KIAA1378; klhl8; zgc:158266
Common Name KLHL8
Gene Symbol KLHL8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HFHPSNCLAVRAFAESHNRIDLMDMADQYACDHFTEVVECEDFVSVSPQHLHKLLSSSDLNIENEKQVYNAAIKWLLANPQHHSKWLDETLAQVRLPLLPVDFLMGVVAKEQIVKQNLKCRDLLDEARNYHL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.