missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Ku70 (aa 156-252) Control Fragment Recombinant Protein

Product Code. 30211496
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211496

Brand: Invitrogen™ RP103439

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

XRCC6 is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P12956
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2547
Name Human Ku70 (aa 156-252) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5'-deoxyribose-5-phosphate lyase Ku70; 5'-dRP lyase Ku70; 5'-dRP/AP lyase Ku70; 70 kDa subunit of Ku antigen; 70 kDa; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase II, 70 kDa subunit; CT; CTA-216E10.7; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; G22p1; Ku autoantigen p70 subunit; ku autoantigen protein p70 homolog; Ku autoantigen, 70 kDa; Ku p70; Ku70; Ku70 DNA-binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa); Kup70; Lupus Ku autoantigen protein p70; ML8; OTTHUMP00000028581; thyroid autoantigen; thyroid autoantigen 70 kDa; thyroid autoantigen 70 kD (Ku antigen); thyroid autoantigen 70 kDa (Ku antigen); Thyroid-lupus autoantigen; thyroid-lupus autoantigen p70; TLAA; XELAEV_18023498mg; X-ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog; X-ray repair cross complementing 6; X-ray repair cross-complementing protein 6; xrcc6; xrcc6.L
Common Name Ku70
Gene Symbol XRCC6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DVQFKMSHKRIMLFTNEDNPHGNDSAKASRARTKAGDLRDTGIFLDLMHLKKPGGFDISLFYRDIISIAEDEDLRVHFEESSKLEDLLRKVRAKETR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.