missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208584

Invitrogen™ Human LAMTOR5 Control Fragment Recombinant Protein

Product Code. 30208584
Click to view available options
Quantity:
100 μL
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30208584

Marque: Invitrogen™ RP89459

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52352 (PA5-52352. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HBXIP, also named as XIP, belongs to the HBXIP family. It is originally identified by its interaction with the C-terminus of hepatitis B virus (HBV) X protein (HBx). HBXIP is a regulator of centrosome dynamics and cytokinesis. HBXIP is able to up-regulate S100A4 though activating STAT4 and inducing DNA methylation of PTEN. HBXIP is a cellular 18kd protein and cytoplasm stain.
TRUSTED_SUSTAINABILITY

Spécification

Accession Number O43504
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10542
Name Human LAMTOR5 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110003H18Rik; HBV X-interacting protein; HBV X-interacting protein homolog; HBx-interacting protein; HBX-interacting protein homolog; HBXIP; hepatitis B virus x interacting protein; Hepatitis B virus X-interacting protein; hepatitis B virus x-interacting protein (9.6 kD); hepatitis B virus X-interacting protein homolog; LAMTOR5; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 5; late endosomal/lysosomal adaptor, MAPK and MTOR activator 5; MGC71071; ragulator complex protein LAMTOR5; XIP
Common Name LAMTOR5
Gene Symbol LAMTOR5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VMFSSKERGRCTVINFVPLEAPLRSTPRSRQVTEACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis