missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LC3B (aa 1-30) Control Fragment Recombinant Protein

Product Code. 30196981
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196981

Brand: Invitrogen™ RP104489

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LC3B (Autophagy Marker Light Chain 3B, MAP1A/MAP1B LC3 B) in humans, is encoded by the gene MAP1LC3B (Microtubule-associated proteins 1A/1B light chain 3B). LC3B is associated with microtubule assembly and important is in neurogenesis. Recent studies indicate that LC3B plays a vital role in autophagy, a process that involves the bulk degradation of cytoplasmic component. Three human LC3 isoforms undergo post-translational modifications during autophagy. Macroautophagy is the major inducible pathway for the general turnover of cytoplasmic constituents in eukaryotic cells, it is also responsible for the degradation of active cytoplasmic enzymes and organelles during nutrient starvation. Macroautophagy involves the formation of double-membrane bound autophagosomes which enclose the cytoplasmic constituent targeted for degradation in a membrane bound structure, which then fuse with the lysosome (or vacuole) releasing a single-membrane bound autophagic bodies which are then degraded within the lysosome (or vacuole). LC3B is a microtubule-associated protein that mediate the physical interactions between microtubules and components of the cytoskeleton. LC3B may play a role in processes involving cancer, aging, metabolic and neurodegenerative disorders and cardiovascular/pulmonary diseases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number A6NCE7, Q9GZQ8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 643246, 81631
Name Human LC3B (aa 1-30) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1010001C15Rik; Atg8; ATG8E; ATG8F; ATG8G; Autophagy-related protein LC3 B; autophagy-related ubiquitin-like modifier LC3 B; LC3; LC3 beta; LC3A; LC3B; light chain 3; MAP1 light chain 3-like protein 2; MAP1A/1 B light chain 3 B; MAP1A/1 BLC3; MAP1A/MAP1B LC3 A; MAP1A/MAP1B LC3 B; MAP1A/MAP1B light chain 3 B; Map1alc3; MAP1BLC3; MAP1LC3; MAP1LC3A; MAP1LC3B; MAP1LC3B2; MAP1LC3B-a; microtubule associated protein 1 light chain 3 beta; microtubule associated protein 1 light chain 3 beta 2; microtubule-associated protein 1 light chain 3; microtubule-associated protein 1 light chain 3 beta; microtubule-associated protein 1 light chain 3 beta 2; microtubule-associated proteins 1 A/1 B light chain 3; microtubule-associated proteins 1 A/1 B light chain 3 beta 2; Microtubule-associated proteins 1 A/1 B light chain 3 B; Microtubule-associated proteins 1 A/1 B light chain 3 B-like; Microtubule-associated proteins 1 A/1 B light chain 3 B-like protein; Mpl3; RP11-346K17.1; wu:fb60g11; zbs559; zgc:56434
Common Name LC3B
Gene Symbol MAP1LC3B, MAP1LC3B2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MPSEKTFKQRRTFEQRVEDVRLIREQHPTK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.