missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201242

Invitrogen™ Human LCAT (aa 133-214) Control Fragment Recombinant Protein

Product Code. 30201242
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201242

Brand: Invitrogen™ RP100005

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83739 (PA5-83739. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lecithin: cholesterol acyltransferase (LCAT) is the plasma enzyme responsible for most HDL cholesteryl esters in human plasma. In species with cholesteryl ester transfer protein (CETP) it is also responsible for a significant proportion of VLDL and LDL cholesteryl esters. LCAT, through the esterification of cholesterol, plays a role in the reverse cholesterol transport pathway by facilitating the net movement of cholesterol from peripheral tissues back to the liver for excretion. LCAT deficiency results in low levels of plasma HDL, whereas a transgenic overexpression of LCAT results in increased plasma HDL concentrations.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P04180
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3931
Name Human LCAT (aa 133-214) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI046659; D8Wsu61e; Lcat; lecithin cholesterol acyltransferase; lecithin-cholesterol acyltransferase; lecithin-cholesterol acyltransferase Lcat; phosphatidylcholine-sterol acyltransferase; phosphatidylcholine--sterol O-acyltransferase; Phospholipid-cholesterol acyltransferase; testicular secretory protein Li 24
Common Name LCAT
Gene Symbol LCAT
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VEYLDSSKLAGYLHTLVQNLVNNGYVRDETVRAAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.