missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LGALS3BP (aa 114-232) Control Fragment Recombinant Protein

Product Code. 30200129
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200129

Brand: Invitrogen™ RP93676

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51411 (PA5-51411. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q08380
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3959
Name Human LGALS3BP (aa 114-232) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 90 K; basement membrane autoantigen p105; BTBD17B; CyCAP; Cyp-C-associated protein; galectin 3 binding protein; galectin-3-binding protein; gp90; L3 antigen; Lectin; lectin galactoside-binding soluble 3 binding protein; lectin galactoside-binding soluble 3-binding protein; lectin, galactoside binding soluble 3 binding protein; lectin, galactoside-binding, soluble, 3 binding protein; Lgals3bp; M2BP; mac-2 BP; mac-2-binding protein; MAC2BP; MAC-2 BP; MAC-2-BP; mama; peptidylprolyl isomerase C-associated protein; Ppicap; Protein 90 K; Protein MAMA; serum protein 90 K; similar to Galectin-3 binding protein precursor (Lectin galactoside-binding soluble 3 binding protein) (Mac-2 binding protein) (Mac-2 BP) (MAC2BP) (Tumor-associated antigen 90 K); TANGO10B; transport and golgi organization 10 homolog B; tumor-associated antigen 90 K
Common Name LGALS3BP
Gene Symbol LGALS3BP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.