missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human LKB1 (aa 30-152) Control Fragment Recombinant Protein

Product Code. 30209721
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209721

Brand: Invitrogen™ RP89755

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LKB1 (also known as STK11 - Serine/threonine-protein kinase STK11), a member of the serine/threonine kinase family, is a tumor suppressor. LKB1 physically associates with p53 and regulates specific p53 dependent apoptosis pathways. LKB1 is present in both the cytoplasm and nucleus of living cells and translocates to mitochondria during apoptosis. LKB1 functions as a master upstream protein kinase, regulating AMPK related kinases as well as AMPK. Mutations in LKB1 gene are associated with Peutz Jeghers syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15831
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6794
Name Human LKB1 (aa 30-152) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA408040; CAMK group; CAMKL family; hLKB1; liver kinase B1; Liver kinase B1 homolog; LKB 1; LKB1; LKB-1; LKB1(S); Par-4; PJS; polarization-related protein LKB1; R75140; renal carcinoma antigen NY-REN-19; serine/threonine kinase 11; serine/threonine-protein kinase 11; serine/threonine-protein kinase LKB1; serine/threonine-protein kinase STK11; STK11
Common Name LKB1
Gene Symbol STK11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNEEKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.