missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. Abnova™ Human LOC339674 Full-length ORF (CAK54390.1, 1 a.a. - 107 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human LOC339674 Full-length ORF (CAK54390.1, 1 a.a. - 107 a.a.) Recombinant Protein with GST-tag at N-terminal

Product Code. 16170164
Change view
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
16170164 25 μg 25µg
16160164 10 μg 10µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 16170164 Supplier Abnova™ Supplier No. H00339674P01.25ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Used for AP, Array, ELISA, WB-Re

Sequence: MSMAACPEAPEPSFLREVPSSPASTQWHRPCNFRQVEANPRKEPKNLVWRDVSLGQTSRTPRGSGLELVRVCGGGMQRDKTVVEERVGEERERERERVWGERASMGR

Specifications

Accession Number CAK54390.1
For Use With (Application) Antibody Production, Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 339674
Molecular Weight (g/mol) 38.17kDa
Name LOC339674 (Human) Recombinant Protein (P01)
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Immunogen MSMAACPEAPEPSFLREVPSSPASTQWHRPCNFRQVEANPRKEPKNLVWRDVSLGQTSRTPRGSGLELVRVCGGGMQRDKTVVEERVGEERERERERVWGERASMGR
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias bK250D10.8
Common Name LOC339674
Gene Symbol LOC339674
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.