missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208361

Invitrogen™ Human LRRK2 (aa 1518-1653) Control Fragment Recombinant Protein

Artikelnummer. 30208361
Click to view available options
Quantity:
100 μL
Packungsgröße:
100µL
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 30208361

Marke: Invitrogen™ RP89821

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LRRK2 is a multidomain protein that includes a kinase domain, a GTPase domain, and a leucine-rich repeat (LRR) domain. Mutations in LRRK2 have been associated with Parkinson's disease. LRRK2 is a member of the leucine-rich repeat kinase family and encodes a protein with an ankryin repeat region, a leucine-rich repeat domain, a kinase domain, a DFG-like motif, a RAS domain, a GTPase domain, a MLK-like domain, and a WD40 domain. The protein is present largely in the cytoplasm but also associates with the mitochondrial outer membrane.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number Q5S007
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 120892
Name Human LRRK2 (aa 1518-1653) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4921513O20Rik; 9330188B09Rik; augmented in rheumatoid arthritis 17; AURA17; AW561911; BC 300-268; cI-46; D630001M17Rik; DARDARIN; DKFZp434H2111; FLJ45829; Gm927; leucine rich repeat kinase 2; leucine-rich repeat kinase 2; leucine-rich repeat serine/threonine-protein kinase 2; LRR kinase 2; LRRK 2; Lrrk2; LRRK-2; PARK8; RIPK7; ROCO2
Common Name LRRK2
Gene Symbol LRRK2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt