missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198681

Invitrogen™ Human LSM8 (aa 4-90) Control Fragment Recombinant Protein

Product Code. 30198681
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198681

Brand: Invitrogen™ RP92711

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54154 (PA5-54154. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the like-Sm family of proteins. The encoded protein consists of a closed barrel shape, made up of five anti-parallel beta strands and an alpha helix. This protein partners with six paralogs to form a heteroheptameric ring which transiently binds U6 small nuclear RNAs and is involved in the general maturation of RNA in the nucleus.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O95777
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51691
Name Human LSM8 (aa 4-90) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2010003I05Rik; AW214405; Lsm8; LSM8 homolog, U6 small nuclear RNA associated; LSM8 homolog, U6 small nuclear RNA associated (S. cerevisiae); LSM8 U6 small nuclear RNA associated; MAK31-like protein; Naa38; N-alpha-acetyltransferase 38, NatC auxiliary subunit; N-alpha-acetyltransferase 38, NatC auxiliary subunit; LSM8 homolog, U6 small nuclear RNA associated; U6 snRNA-associated Sm-like protein LSm8
Common Name LSM8
Gene Symbol LSM8
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSALDLGNIRAEP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.