missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211717

Invitrogen™ Human LTBR (aa 153-224) Control Fragment Recombinant Protein

Product Code. 30211717
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30211717 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30211717 Supplier Invitrogen™ Supplier No. RP108459

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111533 (PA5-111533. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the tumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cells of epithelial and myeloid lineages, but not on T and B lymphocytes. The protein specifically binds the lymphotoxin membrane form (a complex of lymphotoxin-alpha and lymphtoxin-beta). The encoded protein and its ligand play a role in the development and organization of lymphoid tissue and tranformed cells. Activation of the encoded protein can trigger apoptosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P36941
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4055
Name Human LTBR (aa 153-224) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI256028; CD18; D12S370; LT beta-R; Ltar; LT-beta receptor; LTbetaR; LT-BETA-R; Ltbr; lymphotoxin B receptor; lymphotoxin beta receptor; lymphotoxin beta receptor (TNFR superfamily, member 3); lymphotoxin-beta receptor; TNF receptor-related protein; Tnfbr; TNFCR; TNFR2-RP; TNFR3; TNF-RIII; TNF-R-III; TNFR-III; TNFRrp; TNFR-RP; Tnfrsf3; Tumor necrosis factor C receptor; tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor superfamily member 3; tumor necrosis factor receptor superfamily, member 3; tumor necrosis factor receptor type III
Common Name LTBR
Gene Symbol Ltbr
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.