missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196150

Invitrogen™ Human LYK5 (aa 287-413) Control Fragment Recombinant Protein

Product Code. 30196150
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30196150 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30196150 Supplier Invitrogen™ Supplier No. RP91427

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LYK5; STE20-related Adaptor Protein (STRAD); FLJ90524. Gene Map Locus is 17q23.3 and members of STE-20 like kinase family are known to stimulate MAPK pathways by directly activating MAPKKK. STRAD is a novel pseudokinase member of this family consisting of a STE-20 like kinase domain but lacks several residues that are required for its catalytic activity. It specifically binds LKB1 and plays a key role in regulating tumor suppressor activities of LKB1. It functions as an upstream activator of LKB1 and also directs the sub-cellular localization of LKB1 by anchoring it in the cytoplasm. STRAD-LKB1 interaction results in phosphorylation of STRAD and enhanced autophosphorylation of LKB1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7RTN6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 92335
Name Human LYK5 (aa 287-413) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610019A05Rik; 6030402H20Rik; AI480680; E130112C09Rik; LYK5; NY-BR-96; PMSE; protein kinase LYK5; serologically defined breast cancer antigen NY-BR-96; STE20-like pseudokinase; STE20-related adapter protein; STE20-related kinase adapter protein alpha; STE20-related kinase adaptor alpha; Stlk; Strad; STRAD alpha; Strada
Common Name LYK5
Gene Symbol STRADA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.