missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MACC1 (aa 114-200) Control Fragment Recombinant Protein

Product Code. 30194541
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30194541 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30194541 Supplier Invitrogen™ Supplier No. RP92824

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54139 (PA5-54139. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MACC1 (Metastasis associated in colon cancer 1) is a key regulator of the hepatocyte growth factor (HGF)-HGF receptor (MET) pathway, which is involved in cellular growth, epithelial-mesenchymal transition, angiogenesis, cell motility, invasiveness, and metastasis. MACC1 protein consists of four domains: ZU5, SH3, and two C-terminal death domains (DD). Expression of MACC1 was found significantly upregulated in malignant tissues (colon cancer of all stages as well as liver and lung metastases) compared to normal tissues or adenomas. MACC1 represents an early and crucial prognostic indicator for colon cancer metastasis that is independent of age, sex, tumor infiltration, nodal status, and lymph vessel invasion. Besides its involvement in signal transduction with the MET receptor, MACC1 also links MET signaling and apoptosis. MACC1 may also be an important therapeutic target for colorectal cancer treatment. At least two isoforms of MACC1 are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6ZN28
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 346389
Name Human MACC1 (aa 114-200) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4732474O15Rik; 7A5; Gm267; MACC1; metastasis associated in colon cancer 1; metastasis-associated in colon cancer protein 1; putative binding protein 7a5; RGD1309838; SH3 domain-containing protein 7a5; SH3BP4L
Common Name MACC1
Gene Symbol MACC1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DSSGDELDVHQLLRQTSSRNSGRSKSVSELLDILDDTAHAHQSIHNSDQILLHDLEWLKNDREAYKMAWLSQRQLARSCLDLNTISQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.