missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210643

Invitrogen™ Human MAEL (aa 77-155) Control Fragment Recombinant Protein

Product Code. 30210643
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210643

Brand: Invitrogen™ RP94271

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85064 (PA5-85064. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The mammalian homolog of the Drosophila protein Maelstrom is expressed in the male germline and localizes to the sex body in spermatocytes and the chromatid body in round spermatids. Similar to its expression in Drosophila, Maelstrom is a component of nuages, a germ-cell specific organelle and is thought to be essential for spermatogenesis and transposon repression during meiosis. In humans, Maelstrom has been found to be expressed only in the testis and in various cancer cell lines. Treatment of these cell lines with the demethylating agent 5'-Aza-2-Deoxycytidine significantly upregulated Maelstrom levels, indicating that its expression is regulated by DNA methylation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96JY0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84944
Name Human MAEL (aa 77-155) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933405K18Rik; AU019877; cancer/testis antigen 128; CT128; MAEL; maelstrom homolog; maelstrom homolog (Drosophila); maelstrom spermatogenic transposon silencer; protein maelstrom homolog; RGD1309333; RP11-102C16.1; SPATA35; spermatogenesis associated 35; testicular tissue protein Li 116
Common Name MAEL
Gene Symbol MAEL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.