missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAMSTR (aa 125-182) Control Fragment Recombinant Protein

Código de producto. 30181377
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30181377

missing translation for 'mfr': Invitrogen™ RP99168

Please to purchase this item. Need a web account? Register with us today!

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65581 (PA5-65581. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional coactivator. Stimulates the transcriptional activity of MEF2C. Stimulates MYOD1 activity in part via MEF2, resulting in an enhancement of skeletal muscle differentiation.
TRUSTED_SUSTAINABILITY

Especificaciones

Accession Number Q6ZN01
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 284358
Name Human MAMSTR (aa 125-182) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias likely ortholog of MEF2-activating SAP transcriptional regulator; MAMSTR; MASTR; MEF2 activating motif and SAP domain containing transcriptional regulator; MEF2-activating motif and SAP domain-containing transcriptional regulator; MEF2-activating SAP transcriptional regulatory protein
Common Name MAMSTR
Gene Symbol MAMSTR
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado