missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MAVS (aa 415-500) Control Fragment Recombinant Protein

Product Code. 30212491
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212491

Brand: Invitrogen™ RP103160

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84160 (PA5-84160. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Two distinct signaling pathways activate the host innate immunity against viral infection. One pathway is reliant on members of the Toll-like receptor (TLR) family while the other uses the RNA helicase RIG-I as a receptor for intracellular viral double-stranded RNA as a trigger for the immune response. MAVS is a mitochondrial membrane protein that was identified as a critical component in the IFN beta signaling pathways that recruits IRF-3 to RIG-I, leading to its activation and that of NF-kappa-B. MAVS is also thought to interact with other components of the innate immune pathway such as the TLR adapter protein TRIF, TRAF2 and TRAF6. MAVS also interacts with the IKK-alpha, IKK-beta and IKK-iota kinases through its C-terminal region. Cleavage of this region by the Hepatitis C virus (HCV) protease allows HCV to escape the host immune system. Multiple isoforms of MAVS are known to exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q7Z434
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57506
Name Human MAVS (aa 415-500) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CARD adapter inducing interferon beta; CARD adaptor inducing IFN-beta; Cardif; D430028G21Rik; IFN-B promoter stimulator 1; IFN-beta promoter stimulator-1; interferon beta promoter stimulator protein 1; interferon-beta promoter stimulator protein 1; IPS1; IPS-1; KIAA1271; MAVS; mitochondrial antiviral signaling protein; mitochondrial anti-viral signaling protein; mitochondrial antiviral-signaling protein; Putative NF-kappa-B-activating protein 031 N; virus-induced signaling adapter; virus-induced signaling adaptor; virus-induced-signaling adapter; VISA
Common Name MAVS
Gene Symbol MAVS
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.