missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201634

Invitrogen™ Human MEF2B (aa 65-205) Control Fragment Recombinant Protein

Product Code. 30201634
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30201634 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30201634 Supplier Invitrogen™ Supplier No. RP102465

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52095 (PA5-52095. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The myocyte enhancer factor-2 (MEF-2) family of transcription factors associated with co-repessors or co-activators to regulate development and function of T cells, neuronal cells and muscle cells. Four family members arise from alternatively spliced transcripts, termed MEF-2A, -2B, -2C and -2D. These members bind as homo- and heterodimers to the MEF-2 site in the promoter region of affected genes. Differential regulation in the expression of the four transcripts implies functional distinction for each during embryogenesis and development. The process of differentiation from mesodermal precursor cells to myoblasts has led to the discovery of a variety of tissue-specific factors that regulate muscle gene expression.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q02080
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 100271849
Name Human MEF2B (aa 65-205) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310045N01Rik; AI451606; BLOC-1-related complex subunit 8; Borcs8; BORCS8-MEF2B; BORCS8-MEF2B readthrough; LOC729991-MEF2B; LOC729991-MEF2B readthrough; MADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2 B); MEF2B; MEF2B neighbor gene protein homolog; Mef2bnb; MEF2BNB-MEF2B; MEF2BNB-MEF2B readthrough; myocyte enhancer factor 2 B; myocyte-specific enhancer factor 2 B; protein MEF2BNB; RIKEN cDNA 2310045N01 gene; RSRFR2; Serum response factor-like protein 2; XMEF2
Common Name MEF2B
Gene Symbol MEF2B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLLKYTEYSEPHESRTNTDILETLKRRGIGLDGPELEPDEGPEEPGEKFRRLAGEGGDPALPRPRLYPAAPAMPSPDVVYGALPPPGCDPSGLGEALPAQSRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.