missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MLK4 (aa 897-1033) Control Fragment Recombinant Protein

Product Code. 30205558
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205558

Brand: Invitrogen™ RP89790

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (33%), Rat (33%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52460 (PA5-52460. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MLK4 or mixed lineage kinase 4 belongs to the superfamily of MAP kinase kinases (MAP3K1) which contain both ser/thr and tyr kinases activity in their catalytic domains. The structure of this kinase family incorporates an N-terminal Src homology (SH3) domain, followed by the kinase domain, a leucine zipper region, and a CDC42 /RAC -interactive binding (CRIB) motif, but divergent C-terminal regions. MLK4 is highly expressed in kidney and pancreas. MLK4 is a negative regulator of TLR4 and does not activate JNK1/MAPK8 pathway, p38/MAPK14, nor ERK2/MAPK1 pathways.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5TCX8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 84451
Name Human MLK4 (aa 897-1033) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC021891; cDNA sequence BC021891; dJ862P8.3; Kiaa1804; MAP3K21; Mitogen-activated protein kinase kinase kinase 21; Mitogen-activated protein kinase kinase kinase MLK4; mixed lineage kinase 4; mKIAA1804; MLK4; RGD1306091; similar to Mixed lineage kinase 4
Common Name MLK4
Gene Symbol MAP3K21
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GNPTPTGATIISATGASALPLCPSPAPHSHLPREVSPKKHSTVHIVPQRRPASLRSRSDLPQAYPQTAVSQLAQTACVVGRPGPHPTQFLAAKERTKSHVPSLLDADVEGQSRDYTVPLCRMRSKTSRPSIYELEKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.