missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MLLT10 (aa 928-1020) Control Fragment Recombinant Protein

Product Code. 30210162
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210162

Brand: Invitrogen™ RP110037

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Translocations affecting chromosome 11q23 involve many partner chromosome regions and occur in various leukemias. The 11q23 gene involved in the translocations is MLL. MLLT10 is the partner gene to MLL1 involved in t(10;11)(p12;q23) translocations. In an analysis of two leukemia patients, the in t(10;11)(p12;q23) translocation fuses MLL1, a SET domain containg histone methyltransferase, to the MLLT10 gene. The MLLT10 gene encodes a predicted 1,027-amino acid protein containing an N-terminal zinc finger and a C-terminal leucine zipper domain. The MLLT10 gene is one of the few MLL partner genes to be independently rearranged with a third gene in leukemia, the CALM gene in the t(10;11)(p12;q14) translocation. Chimeric fusion proteins MLL/AF10 and CALM/AF10 consistently retain the leucine zipper motif of MLLT10. The leucine zipper interacts with GAS41, a protein previously identified as the product of an amplified gene in a glioblastoma. GAS41 interacts with integrase interactor-1 (INI1), a component of the SWI/SNF complex, which acts to remodel chromatin and to modulate transcription. Retention of the leucine zipper in the MLL and CALM fusions suggested that a key feature of these chimeric proteins may be their ability to interfere in normal gene regulation through interaction with the adenosine triphosphate-dependent chromatin remodeling complexes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P55197
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8028
Name Human MLLT10 (aa 928-1020) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Af10; af-10; ALL1-fused gene from chromosome 10 protein; B130021D15Rik; D630001B22Rik; DKFZp686E10210; MGC75086; mKIAA4140; MLLT10; myeloid/lymphoid or mixed lineage-leukemia translocation to 10 homolog; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 10; myeloid/lymphoid or mixed-lineage leukemia translocated to, 10; myeloid/lymphoid or mixed-lineage leukemia; translocated to, 10; protein AF-10; translocated to, 10; type I AF10 protein; type III AF10 protein; type IV AF10 protein
Common Name MLLT10
Gene Symbol MLLT10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IVGALNGVMQTPVTMSQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQILIHQQQFQQLLNSQQLTPVHRHPHFTQLPPTHFSPSM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.