missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196518

Invitrogen™ Human MX2 (aa 9-84) Control Fragment Recombinant Protein

Product Code. 30196518
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196518

Brand: Invitrogen™ RP95904

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83132 (PA5-83132. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the Dynamin family include GTPase, microtubule-associated proteins that are involved in cellular trafficking, including microtubule bundling and endocytosis. Mx1, also known as MxA, an interferon (IFN)-induced protein, acquires a high degree of resistance to influenza A virus and the rhabdo-virus vesicular stomatitis virus (VSV), which suggests that Mx1 plays an active role against influenza virus and the rhabdovirus VSV. Mx1 is a cytoplasmic protein that is 63% identical to the Mx2 protein, which lacks antiviral activity. Mx2 is also known as MxB and is localized at the cytoplasmic face of nuclear pores. Mx2 expression is not interferon-dependent and this protein is thought to regulate the efficiency and/or kinetics of nuclear import, a function which may have been usurped by its antiviral relatives.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P20592
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4600
Name Human MX2 (aa 9-84) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI528743; interferon-induced GTP-binding protein Mx2; interferon-induced GTP-binding protein Mx3; interferon-regulated resistance GTP-binding protein MXB; MX dynamin like GTPase 2; MX dynamin-like GTPase 2; Mx2; Mx-2; Mx3; MXB; myxovirus (influenza virus) resistance 2; myxovirus (influenza virus) resistance 3; myxovirus resistance protein 2; myxovirus resistance protein 3; p78-related protein; protein MxB; second interferon-induced protein p78
Common Name MX2
Gene Symbol MX2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.