missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195633

Invitrogen™ Human MYH7 (aa 1191-1335) Control Fragment Recombinant Protein

Product Code. 30195633
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195633

Brand: Invitrogen™ RP89004

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51547 (PA5-51547. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P12883
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4625
Name Human MYH7 (aa 1191-1335) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias beta cardiac myosin heavy chain; beta myosin heavy chain; beta-MHC; beta-myosin; beta-myosin heavy chain; beta-myosin-heavy-chain; B-MHC; cardiac muscle myosin heavy chain 7 beta; cardiac myosin heavy chain beta isoform; CMD1S; CMH1; LOC100727138; mg:cb02g011; MPD1; Myh7; MYH-beta/slow; MyHC-alpha; Myhcb; Myhc-b; myHC-beta; MyHC-I; MyHC-slow; myopathy, distal 1; myosin beta heavy chain; myosin heavy chain 1; myosin heavy chain 7; myosin heavy chain cardiac alpha; myosin heavy chain polypeptide 7 cardiac muscle fetal; myosin heavy chain slow; myosin heavy chain slow isoform; myosin heavy chain slow type 1 (beta cardiac); myosin heavy chain, cardiac muscle beta isoform; myosin heavy chain, cardiac muscle, fetal; myosin heavy chain, polypeptide 7; myosin, heavy chain 7, cardiac muscle, beta; myosin, heavy polypeptide 7, cardiac muscle, beta; myosin-7; rhabdomyosarcoma antigen MU-RMS-40.7 A; slow myosin heavy chain; smyhc3; SPMD; SPMM; type slow/beta myosin heavy chain; Unknown (protein for IMAGE:7985957); ventricular myosin heavy chain; vmhc
Common Name MYH7
Gene Symbol Myh7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.